PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr026417.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 352aa    MW: 40046.7 Da    PI: 7.9842
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr026417.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.71e-161462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l+++++++G+g +W + +++ g++R++k+c++rw++yl
      Pbr026417.1 14 KGPWSPEEDSKLKEYIEKYGTGgNWIALPQKAGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding38.42.8e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g ++ eEd ++  ++   G++ W+ Ia+ ++ gRt++++k++w++
      Pbr026417.1  69 GEFSDEEDRIICSLFVSIGSR-WSVIAAQLP-GRTDNDIKNYWNT 111
                      789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.093966IPR017930Myb domain
SuperFamilySSF466894.97E-2711109IPR009057Homeodomain-like
SMARTSM007174.3E-131364IPR001005SANT/Myb domain
PfamPF002497.4E-161462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.1E-251569IPR009057Homeodomain-like
CDDcd001671.11E-91662No hitNo description
PROSITE profilePS5129416.30967117IPR017930Myb domain
SMARTSM007171.3E-1167115IPR001005SANT/Myb domain
PfamPF002497.7E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.7E-2370117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDSKLKEYIE KYGTGGNWIA LPQKAGLKRC GKSCRLRWLN  60
YLRPNIKHGE FSDEEDRIIC SLFVSIGSRW SVIAAQLPGR TDNDIKNYWN TKLKKKLMGM  120
HMGPPRPHNY HKNLLKPPPF PSSSHHNYQN QPLIPSEPLS SLYKDLSNYN RSFFGFEVPV  180
PLPPQVSLTS NNFSNISTNS SSSFFPTLNY PAGVKKNNNI NNLLVFGSEG SCSTSSDGSC  240
NNQISYDYCS RSEINNIKQE EMGFDHQSFM MLNYGNQWTE RSNGFYFGSE NNTLEFTDLD  300
EDVKQQLIST RSKNNYNNNN TIINESSKSN SLLFNVDESK TEDDEKVMYF Y*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-27141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0744720.0DQ074472.1 Malus x domestica MYB24 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009335968.10.0PREDICTED: transcription factor RAX1-like
TrEMBLQ2LME00.0Q2LME0_MALDO; MYB24
STRINGPOPTR_0009s01270.11e-112(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.15e-74myb domain protein 36